SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OBART03G27420.1 from Oryza barthii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OBART03G27420.1
Domain Number 1 Region: 82-277
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 6.42e-62
Family Branched-chain alpha-keto acid dehydrogenase Pyr module 0.0000117
Further Details:      
 
Domain Number 2 Region: 262-398
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 7.98e-36
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OBART03G27420.1
Sequence length 399
Comment pep:novel chromosome:ABRL00000000:3:22836963:22840028:1 gene:OBART03G27420 transcript:OBART03G27420.1 description:""
Sequence
MAAASSLHAAPRVGSSSPFSSSSAGRRSASAARSVRVAAAAGSGAARRAGGRMVARAAVA
SKAESPASAASSKSDGHEVLLFEALREALIEEMKEDPTVCVFGEDVGHYGGSYKVTKGLA
EMFGDLRVLDTPIAENSFTGMGVGAAMKGLRPVVEGMNMGFLLLAYNQISNNCGMLHYTS
GGQFKIPIVIRGPGGVGRQLGAEHSQRLESYFQSIPGLQMVACSTPYNAKGLMKAAIRSE
NPVVLFEHVLLYNLKEKIPDEEYVLCLEEAEMVRPGEHVTILTYSRMRYHVMQAAKTLVN
KGYDPEVIDIRSLKPFDLHTIGNSIKKTHRVLIVEECMRTGGIGASLRSAIIDNFWDYLD
APIMCLSSQDVPTPYAAPLEDATVVQPAQIVAAVEQICQ
Download sequence
Identical sequences A0A0D3FLR2
OBART03G27420.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]