SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OBART04G07410.1 from Oryza barthii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OBART04G07410.1
Domain Number 1 Region: 214-291
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000001
Family B3 DNA binding domain 0.0047
Further Details:      
 
Domain Number 2 Region: 143-194
Classification Level Classification E-value
Superfamily (Trans)glycosidases 0.000000487
Family beta-glycanases 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OBART04G07410.1
Sequence length 413
Comment pep:novel chromosome:ABRL00000000:4:9208944:9214605:-1 gene:OBART04G07410 transcript:OBART04G07410.1 description:""
Sequence
MEQIHGARRPSANLLPPFPATDVEGALTFKGLYAPLDIISDRAIDVSSYRCNIWYFIAVH
KCLGLYSENGQYCTNVDRLCTLYISLKKEYGWSSAVKRMPLDFLGGEKFQEAADNYVRPL
LTKGVPSLFSDLSPLYEQPGKVYSSLLADFFVKNSNRAVFEIELKWYRIEAKQGKLNYKD
SDELLEFFQKRSILTGHPPDGCYSKPFAKPVVKALPPEIVASCNGYHGKYLTLVTRHNKP
VNVRLEKIGQSFYICKGWKKFVELTGLRVGQCIRFSVSSPSTLDLLVLDKHGVPKLPMPA
SSEEHLRFKAKRSIHQNSKVMVQSHRLLSITGSTNQRTPNPSLQMISKRRYWEPFNQHDP
SQIDRPLLQPKKRMDKFRPQQWHKAPHSMHFPFLRLPIEEQPSISSEYAINVV
Download sequence
Identical sequences A0A0D3FU50
OBART04G07410.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]