SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OBART04G10000.4 from Oryza barthii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OBART04G10000.4
Domain Number 1 Region: 98-184
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000049
Family B3 DNA binding domain 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OBART04G10000.4
Sequence length 316
Comment pep:novel chromosome:ABRL00000000:4:12328258:12335685:-1 gene:OBART04G10000 transcript:OBART04G10000.4 description:""
Sequence
MQCRGASRASAEVGHRVEDLWEVAEPQLSPSEKLNSCFEDIAVASFHRPLGSQECLDDVW
GQETNLGHAGHYSIWKNGNHSRCDMYDVKPKFVSIGSVGSAFSGTRPVPITLATAYKMQH
GDKLKLQISHDLKIKIKIREAAGTLYMTTGWKQFIYATGLRIGETVLFRMSSCSKARVMV
LNRKGFIRCPIRTTSKSSSVQKKSLPATNQAIKTRTFQHGSTNNSRTGTNKRALDDMSFC
HKTTLTAELRSYIKDIAYSLEESNKFYIVRMNRMFMEQNRVVKFLKTYPSPYAHTYHLTF
TFVAQYFAKEFSKKYI
Download sequence
Identical sequences A0A0D3FV00
OBART04G10000.4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]