SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OBART04G10380.1 from Oryza barthii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OBART04G10380.1
Domain Number 1 Region: 72-171
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000000275
Family B3 DNA binding domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OBART04G10380.1
Sequence length 194
Comment pep:novel chromosome:ABRL00000000:4:12739062:12739835:-1 gene:OBART04G10380 transcript:OBART04G10380.1 description:""
Sequence
MASDPTELRCSSPESSGDAGAEDPAAVDAAEESGGEGGSGHIAAGTEAAPPRPPEPEPEK
VARHGVLPLLGKPYFTCIMCKSHVQPPFQVVVPRSFAPLLPSRTTPATLSWRGRSWGMRF
TGGRLIQRLEAGWRGFAVDNDLRLGDGCVFELLVGGGGEQERVEFRVQVLRAEIPARIRG
RAGGYTSATPIVID
Download sequence
Identical sequences A0A0D3FV40 A2XSR4 Q01KZ7
OsIBCD014113 39946.BGIOSIBCE014941 OBART04G10380.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]