SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OBART04G21030.1 from Oryza barthii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OBART04G21030.1
Domain Number 1 Region: 57-146
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000000124
Family B3 DNA binding domain 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OBART04G21030.1
Sequence length 160
Comment pep:novel chromosome:ABRL00000000:4:20527839:20529393:1 gene:OBART04G21030 transcript:OBART04G21030.1 description:""
Sequence
MAARSGMGGGHQRQAQIGQPSGARRWLRRRFIGDGSTGMGLNMQYKIAHIAVSNLPTIPL
YVYEIQMTNLTKGKMAFSLPFSKQYINNHLSTPIDDLLVTLVGSAESFEMRLKKSKDKRA
TFTTRWNKLVQANLFELGDVCVFLFTEVDDDLCITLEVLN
Download sequence
Identical sequences A0A0D3FYQ3
OBART04G21030.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]