SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OBART04G22880.1 from Oryza barthii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OBART04G22880.1
Domain Number 1 Region: 107-198
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 6.41e-29
Family B3 DNA binding domain 0.00002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OBART04G22880.1
Sequence length 427
Comment pep:novel chromosome:ABRL00000000:4:22017603:22018890:-1 gene:OBART04G22880 transcript:OBART04G22880.1 description:""
Sequence
MEFATTSSRFSKEEEEEEEGEQEMEQEQDEEEEEAEASPREIPFMTSAAAAATASSSSPT
SVSPSATASAAASTSASGSPFRSSDGAGASGSGGGGGGEDVEVIEKEHMFDKVVTPSDVG
KLNRLVIPKQHAEKYFPLDSAANEKGLLLSFEDRTGKLWRFRYSYWNSSQSYVMTKGWSR
FVKEKRLDAGDTVSFCRGAAEATRDRLFIDWKRRADVRDPHRFQRLPLPMTSPYGPWGGG
AGAFFMPPAPPATLYEHHRFRQGFDFRNINPAVPARQLVFFGSPGTGGVHQHPPFATAAA
ATSASSPTPHYGAPPEPLTAGLPMVVDSVPHVNNPAAASKRVRLFGVNLDNPHPDGGQSS
SGHDAGHDANALSLRMPGWQRPAPLRSLELPPHMPAGAAGAESSAASSPSSSSSSKREAH
SSLDLDL
Download sequence
Identical sequences A0A0D3FZC8
OBART04G22880.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]