SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OBART05G25790.3 from Oryza barthii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OBART05G25790.3
Domain Number 1 Region: 93-215
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.35e-43
Family B3 DNA binding domain 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OBART05G25790.3
Sequence length 669
Comment pep:novel chromosome:ABRL00000000:5:22544814:22549981:1 gene:OBART05G25790 transcript:OBART05G25790.3 description:""
Sequence
MTGIDLNTVEEDEEEAAEEVAANGSSPAPARAGAVCLELWHACCRVVDVTLLADAATDEV
YAQLSLVPEKEEVARRADDGEGEDGDGMKQRFARMPHMFCKTLTASDTSTHGGFSVPRRA
AEDCFPPLDYSQQRPSQELVAKDLHGTEWRFRHIYRGQPRRHLLTTGWSAFVNKKKLVSG
DAVLFLRGDDGELRLGVRRAAQLKNGSAFPALYNQCSNLGTLANVAHAVATESVFNIYYN
PRLSQSEFIVPYWKFMKSLSQPFSVGLRFKMRYESEDATERRYTGIITGSGDTDPMWHGS
KWKCLLVRWDDDAEFRRPNRVSPWEIELTSSVSGSHLSTPHSKRLKPCLPHVNPEYMVPR
GGVCPDFAESAQFHKVLQGQELLGFKSHGGTAAATSQPCEARHLQYIDERSCSSDASNSI
LGVPRLGDRAPLGNPGFSYHCSGFGESQRLQKVLQGQELFRPYRGTLVDASMGSNGFHQQ
DSPRAPGVVNKWQAQLHGRAAFHGPPAPALPSQSSSPPSVLMFQQANSKMPRLEFGHGQL
DKHENDRRVRFGPSEGIERREQRIPLQPYPTSGEVIDGQVTVEKSHSPGRHGKDGPDNKA
VGTNSCKIFGISLTEKVPAREELDDGDANYSLQSLKQVPKSLGNSCATVHEQRPVVGRVI
DISTMDMMI
Download sequence
Identical sequences A0A0D3GAT6
OBART05G25790.3 OBART05G25790.5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]