SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OBART06G00740.1 from Oryza barthii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OBART06G00740.1
Domain Number 1 Region: 11-523
Classification Level Classification E-value
Superfamily Acetyl-CoA synthetase-like 1.31e-73
Family Acetyl-CoA synthetase-like 0.00021
Further Details:      
 
Domain Number 2 Region: 748-1108
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 1.02e-39
Family Quinoprotein alcohol dehydrogenase-like 0.0064
Further Details:      
 
Domain Number 3 Region: 539-602
Classification Level Classification E-value
Superfamily ACP-like 0.0000081
Family Peptidyl carrier domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OBART06G00740.1
Sequence length 1110
Comment pep:novel chromosome:ABRL00000000:6:441326:451201:1 gene:OBART06G00740 transcript:OBART06G00740.1 description:""
Sequence
MAAEAAAAKEEEPCCISHAFDRAARRNPTGLAVIHAASSSSSGSDSERRFTCADLLAAVS
TLSRHIAAELSSSTSRHRDESPGCSGRPVEAAAAPRVVGVYASPSVEYIAAVLAVLRCGE
AFLPLDPSWPEERIRWATSSSNAVLVVSSGGLGAAHVFASSSCSVIHMDDDLWQVFEDEK
GGIGRDELAWPCECKKPREFCYVMFTSGSTGKPKGVCGTEKGLLNRFLWMQRWKPLCSDD
LLLFKTSVSFVDHLQEFLSAVLTCTTLVIPPPNDWRANPASLANLIKAYGISRMNLVPSL
MEIILPSLEKNLSWGHNPLKMLIFSGENLSILLWKRVHEILPETTIVNLYGTTEVSGDCT
FFDCTDLPILLKREELTSVPIGFPISNCEVCIATDAEVADEGEMHRSPWRVITLKTMEVQ
HTTELEVESTLNEHPDVSAAAVTFQNNEFLDFRAYLVLKSSTASVEDCQRRKRYKSSEVI
MPSIRSWLIMKLPPAMIPRFFLPMESLPLTSSGKIDYMKLSSLKCALESCETETERITVN
PHLQVIKKAFSDALLVDEVSEFDDFFTLGGNSISAAHVAHKLEIDMRMLYIYSTPSKLLD
ALFTKHGCLLSSSREPHPKKGLDISSSIHSSFNPIATSVDDNFPEVKAHINGDGECAHDA
ISGNYANEVDGQLNRNVPLSNDRYQTKSLLLDTCSNDRNSVDVSPWILNFCLVKKWSIGR
CNRFMHGYEDKLQIEDVCSYVPYNKRGYLQALWNIPLGSCVDASPLLVSNNGMLSIFIGS
HSHRFLCIDGCSGSVRWSVKLEGRVECSAAITGDFSEVVVGCYKGKIYFLDLLTGKQAWT
IQTDGEVKMQPAVDMIRNLIWCGSYDHHLYALNYKDRCCTYKISCGGSIYGSPAIDMTHN
MIYVASTSGLVTAISLEVSSFKIIWQYEAGAPIFGSLAIHHHGGKVICCLVNGLVIALNS
HGSVVWKASVGGPIFAGACLSSGLPTQVLIPSRDGRLYSFDTTSGALLWKYEVGDPITAS
AFVDEVLTATSPGASERFACICTSSGQVHVIRIRADAKEEKVNGSICNDLVQGFAAIDLP
GDIFSSPLMVGGRIFVGCRDDQLHCLTISS
Download sequence
Identical sequences A0A0D3GBZ2
OBART06G00740.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]