SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OBART06G00740.2 from Oryza barthii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OBART06G00740.2
Domain Number 1 Region: 12-566
Classification Level Classification E-value
Superfamily Acetyl-CoA synthetase-like 1.96e-98
Family Acetyl-CoA synthetase-like 0.0000157
Further Details:      
 
Domain Number 2 Region: 791-1096
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 1.37e-38
Family Quinoprotein alcohol dehydrogenase-like 0.0064
Further Details:      
 
Domain Number 3 Region: 582-645
Classification Level Classification E-value
Superfamily ACP-like 0.00000846
Family Peptidyl carrier domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OBART06G00740.2
Sequence length 1148
Comment pep:novel chromosome:ABRL00000000:6:441326:450770:1 gene:OBART06G00740 transcript:OBART06G00740.2 description:""
Sequence
MAAEAAAAKEEEPCCISHAFDRAARRNPTGLAVIHAASSSSSGSDSERRFTCADLLAAVS
TLSRHIAAELSSSTSRHRDESPGCSGRPVEAAAAPRVVGVYASPSVEYIAAVLAVLRCGE
AFLPLDPSWPEERIRWATSSSNAVLVVSSGGLGAAHVFASSSCSVIHMDDDLWQVFEDEK
GGIGRDELAWPCECKKPREFCYVMFTSGSTGKPKGVCGTEKGLLNRFLWMQRWKPLCSDD
LLLFKTSVSFVDHLQEFLSAVLTCTTLVIPPPNDWRANPASLANLIKAYGISRMNLVPSL
MEIILPSLEKNLSWGHNPLKMLIFSGENLSILLWKRVHEILPETTIVNLYGTTEVSGDCT
FFDCTDLPILLKREELTSVPIGFPISNCEVCIATDAEVADEGEMHVTGACLFAGYLEESM
ASNHTEDNGSSTYYRTGDFARRLKSGEFIFLGRKDRTVKIYGQRFSLQEVESTLNEHPDV
SAAAVTFQNNEFLDFRAYLVLKSSTASVEDCQRRKRYKSSEVIMPSIRSWLIMKLPPAMI
PRFFLPMESLPLTSSGKIDYMKLSSLKCALESCETETERITVNPHLQVIKKAFSDALLVD
EVSEFDDFFTLGGNSISAAHVAHKLEIDMRMLYIYSTPSKLLDALFTKHGCLLSSSREPH
PKKGLDISSSIHSSFNPIATSVDDNFPEVKAHINGDGECAHDAISGNYANEVDGQLNRNV
PLSNDRYQTKSLLLDTCSNDRNSVDVSPWILNFCLVKKWSIGRCNRFMHGYEDKLQIEDV
CSYVPYNKRGYLQALWNIPLGSCVDASPLLVSNNGMLSIFIGSHSHRFLCIDGCSGSVRW
SVKLEGRVECSAAITGDFSEVVVGCYKGKIYFLDLLTGKQAWTIQTDGEVKMQPAVDMIR
NLIWCGSYDHHLYALNYKDRCCTYKISCGGSIYGSPAIDMTHNMIYVASTSGLVTAISLE
VSSFKIIWQYEAGAPIFGSLAIHHHGGKVICCLVNGLVIALNSHGSVVWKASVGGPIFAG
ACLSSGLPTQVLIPSRDGRLYSFDTTSGALLWKYEVGDPITASAFVDEVLTATSPGASER
FACICTSSGQVHVIRIRADAKEEKVNGSICNDLVQGFAAIDLPGDIFSSPLMGYQAAAAY
FSYAFLRL
Download sequence
Identical sequences A0A0D3GBZ3
OBART06G00740.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]