SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OBART06G21860.1 from Oryza barthii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OBART06G21860.1
Domain Number 1 Region: 139-243
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.53e-17
Family B3 DNA binding domain 0.0065
Further Details:      
 
Domain Number 2 Region: 315-408
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000000000194
Family B3 DNA binding domain 0.0076
Further Details:      
 
Domain Number 3 Region: 12-124
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000334
Family B3 DNA binding domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OBART06G21860.1
Sequence length 410
Comment pep:novel chromosome:ABRL00000000:6:20826060:20828977:-1 gene:OBART06G21860 transcript:OBART06G21860.1 description:""
Sequence
MPLSAGSLRRRPKFAAPLLSPACLHRLSVPGEFAARLDDDDAAGVGEEEEESGRRAAAVL
VVGPLGKVWRVXLRRSPAGDGEAWLGGGWSELAAAHGLGEGWGVVLRLERRGVASLRVFD
PGFCLARFCTPHAGMRTKDRPRFIKLLQQEDLEKMKIPEKFVQQQLTETYTNNHQNAIIV
CPLGKFWRVELQREQPDVLLRDGWAPFLAAHDLSEGNILLVRYEGNMVFTVEVFLQNGCL
KEYKTAALYLTDGTEGPSNAPQQSAAKVGVSPVKRKRTRRIEGTCLEGPNRKSRASPISV
KVEQHKKHVSIVSQNSFTKEMTAYSIHSLLSVRGTFCSQIGLLEACAITLKISMKKKGSW
RVAFKTANTYGYINGPGWRKFCLENEVKEGDRLTFNAIETTVWHVVIVHC
Download sequence
Identical sequences A0A0D3GIY5
OBART06G21860.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]