SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OBART07G04450.1 from Oryza barthii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OBART07G04450.1
Domain Number 1 Region: 46-243
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 8.03e-62
Family Branched-chain alpha-keto acid dehydrogenase Pyr module 0.000000428
Further Details:      
 
Domain Number 2 Region: 227-363
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 3.01e-39
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.00000915
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OBART07G04450.1
Sequence length 363
Comment pep:novel chromosome:ABRL00000000:7:3413747:3417411:-1 gene:OBART07G04450 transcript:OBART07G04450.1 description:""
Sequence
MAAKSLREIRRAAAAGIGRRRCFSGDAAAAAAAGVAEGKVGGGAGKEVNLFTAINQALHI
ALDTDPRSYVFGEDVGFGGVFRCTTGLADRFGRNRVFNTPLCEQGIAGFAVGLAAMGNRA
IAEIQFADYIFPAFDQACLRYRSGNEFNCGGLTIRSPYGAVGHGGHYHSQSPEAFFCHVP
GLKVIIPRSPREAKGLLLASIRDPNPVVFFEPKWLYRLAVEEVPEEDYMLPLSEAEVIRK
GSDITLIGWGAQLAVLEEACEDAAKDGISCELIDLRTLIPWDKETVEASVSKTGKLLVSH
EAPITGGFGAEIAASITERCFQRLEAPVARVCGLDTPFPLVYETFYMPTKNKVLDAIKAT
VNY
Download sequence
Identical sequences A0A0D3GMR4
OBART07G04450.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]