SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OBART07G05350.1 from Oryza barthii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OBART07G05350.1
Domain Number 1 Region: 430-537
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 9.42e-16
Family B3 DNA binding domain 0.0025
Further Details:      
 
Domain Number 2 Region: 114-230
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000000209
Family B3 DNA binding domain 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OBART07G05350.1
Sequence length 665
Comment pep:novel chromosome:ABRL00000000:7:4083705:4086308:-1 gene:OBART07G05350 transcript:OBART07G05350.1 description:""
Sequence
MAQPPDAAAAAVPPPVVIDRDVWHACAVPYSGVLPGVGTLVYYIPHGHIEQCAEDPALLL
SRLPDPIHPVPCTVADLVLDVDAESGEAYTTISLLPGSHDDTTARRQVPAHGEPGLRFFE
KQLSPADVTSNALVLPAGAEHVLPPLDIAAYQTARLFDVRDLRGKRFEFVHIWDKKRCRY
MLGDLGVNDNDGWRGFVKAKRLATRDTVVFMRRGGGDGDGDGELLVGVRRAPRARGGHHP
RPGVEDNKVVSEVWLAMQGVTPFEVTYYPREGTFEFVVSRDEYIGFSFSPFYPFVPGTTV
HLRMNPLQIAQSISGTVRTFDHLRPWRMLEVDWDQAASPISYRIHRQVNSWQVLRQPQPA
ATTSAVRIRDAIVATPQVQIMAPPRPPPPTTTTGMVPSDDSYAMISLFPGDCYVTHRPLP
AARDPVGGQREFCFFDKKLSPSDVAANGGGSGALFVIPKPSAAEHVLPRIPDLRVTDLQG
GRWEFGHTWSDADTDRRSSSHTLAAGWSAFVKAKRLCVGDTVIFMRRRPGGEPLVGVRLL
MNPDDARRRSQPPVYGTVRDVHSRSEWRMLEVDWDRDSPLAPTMNRRVNSWQVQPVQLAL
PPQGSDEEAAAATTSTAHAGDATTSAPSLALQLQTMASSSSSSAPIIPSRGSAFRIVNPR
DGSQG
Download sequence
Identical sequences A0A0D3GN19
OBART07G05350.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]