SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OBART07G05400.1 from Oryza barthii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OBART07G05400.1
Domain Number 1 Region: 375-476
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 7.59e-19
Family B3 DNA binding domain 0.0024
Further Details:      
 
Domain Number 2 Region: 774-875
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 7.59e-19
Family B3 DNA binding domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OBART07G05400.1
Sequence length 964
Comment pep:novel chromosome:ABRL00000000:7:4114697:4119677:1 gene:OBART07G05400 transcript:OBART07G05400.1 description:""
Sequence
MPLPSCRRREQRPRQSCFQNPECHLRLRARQQRPPESAVQSTLSSSIYFSDHFVLTPPPF
QITPTSIQNSTWLPIPTSPAVAAPPLPRWSPASVASTARARRPPLPSLLPSLCRRSPRRR
ARPLPAPPSNLGGVDGEGAPCAPPPSPIPAGPASSTVSAASSAPATRDYLGGITGHRLGQ
EDDSGGHEYTSVSGIHVPSSSGVAFVSFGQCPQEMISTDLRLGLGPIAATAPLQPPPPPA
AAAAAGSPSATTPEPGHGEATPTTSSSAQFQTQAQQVTRDMWMACAAPKSGRLPTVGSLV
YYFPDGHAEQCLSRPQEPLPGRIFLCKVTDVRLGAAATNEALATISLVPIAADDHAFQLQ
APADPDPAPAQSQSLVSFVKPLTYTDVTKNRFMVPKDDAAAGVLPHIQLNDDVPLRIKDL
SGKEWAFNYTWKAHTRMFRNGWMEFSNANGLVTGDNAVFMRRGNGEMFMAVRRTRNRPAP
FSVEEVIEAVWRAARREPFEVSYCSRQDGDEFVVPRDIVDDGLRARFAPGMAVNFVWAVE
DGKLPTIGPQGEVISIENYATAPATRDYLGGITGHRLGQEDDSGGHEYTSVSGIHVPSSS
GVAFVSFGQCPQEMISTDLRLGLGPIAATAPLQPPPPPAAAAAAGSPSATTPEPGHGEAT
PTTSSSAQFQTQAQQVTRDMWMACAAPKSGRLPTVGSLVYYFPDGHAEQCLSRPQEPLPG
RIFLCKVTDVRLGAAATNEALATISLVPIAADDHAFQLQAPADPDPAPAQSQSLVSFVKP
LTYTDVTKNRFMVPKDDAAAGVLPHIQLNDDVPLRIKDLSGKEWAFNYTWKAHTRMFRNG
WMEFSNANGLVTGDNAVFMRRGNGEMFMAVRRTRNRPAPFSVEEVIEAVWRAARREPFEV
SYCSRQDGDEFVVPRDIVDDGLRARFAPGMAVNFVWAVEDGKLPTIGPQGEVISIENYAT
SIGA
Download sequence
Identical sequences A0A0D3GN26
OBART07G05400.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]