SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OBART07G09910.1 from Oryza barthii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OBART07G09910.1
Domain Number 1 Region: 845-1068,1110-1329
Classification Level Classification E-value
Superfamily L domain-like 1.81e-37
Family Internalin LRR domain 0.046
Further Details:      
 
Domain Number 2 Region: 148-243
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 5.36e-29
Family B3 DNA binding domain 0.0000345
Further Details:      
 
Domain Number 3 Region: 432-596
Classification Level Classification E-value
Superfamily RNI-like 4.47e-24
Family Cyclin A/CDK2-associated p19, Skp2 0.009
Further Details:      
 
Domain Number 4 Region: 612-782
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.21e-17
Family G proteins 0.067
Further Details:      
 
Domain Number 5 Region: 1352-1377
Classification Level Classification E-value
Superfamily WRKY DNA-binding domain 0.00000157
Family WRKY DNA-binding domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OBART07G09910.1
Sequence length 1379
Comment pep:novel chromosome:ABRL00000000:7:8641185:8646465:-1 gene:OBART07G09910 transcript:OBART07G09910.1 description:""
Sequence
MSGYWRRRRSRKPANLEAGNTEGEQREQADHEILRASRNISDGFSDPEDSIAASYPYRSN
SAGSFANYLGLDTFGSTLPASSSLHTWGFRRATDPPDSDQISKSKTSAVGVGLDQDQGEE
PPPQAPGDADDDVGGGGGDAAKVIIEKEHMFDKVVTPSDVGSLNRLVIPRQHAECYFPRD
VAANEKGGGVLLRFEDRAGKPWRFRYSYWNSSQSYVLTKGWSRFVRENGLNAGDTVSFYR
GATEATRDRLFIDSKRKMHHINRLFQLLVRVRTMVSSFGEAGSPPPPPNSPLSTAQNFTY
KALKDCLQDLLYYNLLSIMGRNHKSQSTSSRFACGMDAKIRYTIPKLDALIQFPSLSLPD
PVLGTFAAATLLSNCIFLCRGVLGIMGFLRSENMKEEHRMLQAPAFDDLNYSAQDRITRM
KEQTMPSSLSDPIYLLPTAIRNLLYLDLSNCSDIVQLPPSLGSSFHMLSALNLSCCYSLR
ALPDSLVCLYDLQILLLPFCHNLQNLPVSFGDLSNLRLLDLSGCRSLRLLPDSFVNLGSL
ENLNLSDCIRLKGIPQPFGNLRKLEYLNFAGCYRVDLHDSFTDLKRHLDLSRWWKYNRVH
TQCNLKSYRCLQQIIINRLLSDGFDEGDITSEQSLTSICIFGESGTGKTELLHEIYNDQM
IIEGFHLRIWINMCDEKRLLEKIIEFTTCAYCYDAPSSILEETEHAGCGLDINNYHELTK
VGWKIVEKCGSNPLYIKALSGLLCHSETALSEIDSLAGGIVPALRLCYDLLPSHLKQCFK
FCSLFPKDYVFVRHHIIQLWISQGFVYPEEGSQPEDTGLQYFNELFCRSFFQHCPFSNDH
GDKFVMHELFHDLARSISKDESLSSEDPFFSLPENICHLSLVISDSNTVVLTKEHRHLQS
LMVVRRSASEYSSSFVPLLKILGLNDLLMKCGFLRALNLSCTTIVDLPGSIGRMKHLRFL
AMNNTKIKSLPTEIGQLNALQTLELKDCCCLIELPESTKNLTKLRHLDVQKEPGNIHVSM
PSGLGQLTDLQTLTVFNIGDDLSHCSIRDLKNLSGLRGHVHITGLQNITAGDDAKEANLV
GKQFLQALTLEWCCSSEEMEDEGDKETANQVLQNLQPNTSIQELAIQNYPGNSFPNWIKD
SGLCMLVSITIDNSQDCNEIPYLGDLPCLKFLFIQKMYAVENFGQRSNSLTTDGKHAPGF
PSLEILNLWEMYSLQFWNGTRYGDFPQLRRLSISRCPKLSNLPPLISLLYLSFHCGDKLP
ALSEFPSLKSLKIEGFQKLKSVSFCPEMPMLQKLEISDCKGLVSIDAPLLSVSNLKVVRC
PKLHFGGSWLEGCLMWEEFKRDKCTIKYLLVKTMKDDGWNWRKYGQKDILGSKYQRSKK
Download sequence
Identical sequences A0A0D3GPI4
OBART07G09910.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]