SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OBART10G10410.1 from Oryza barthii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OBART10G10410.1
Domain Number 1 Region: 435-559
Classification Level Classification E-value
Superfamily Tropomyosin 0.00000284
Family Tropomyosin 0.0032
Further Details:      
 
Domain Number 2 Region: 560-760
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000134
Family Tropomyosin 0.0011
Further Details:      
 
Domain Number 3 Region: 935-1040
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0000445
Family Myosin rod fragments 0.0033
Further Details:      
 
Weak hits

Sequence:  OBART10G10410.1
Domain Number - Region: 1417-1583
Classification Level Classification E-value
Superfamily Tropomyosin 0.00235
Family Tropomyosin 0.0033
Further Details:      
 
Domain Number - Region: 314-431
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00392
Family Myosin rod fragments 0.0021
Further Details:      
 
Domain Number - Region: 1027-1114
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00863
Family Myosin rod fragments 0.006
Further Details:      
 
Domain Number - Region: 194-268
Classification Level Classification E-value
Superfamily Tropomyosin 0.0451
Family Tropomyosin 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OBART10G10410.1
Sequence length 2033
Comment pep:novel chromosome:ABRL00000000:10:11927486:11934697:-1 gene:OBART10G10410 transcript:OBART10G10410.1 description:""
Sequence
MAALVGHDARQYSWWWVSHISPKNSKWLQENLNDMDSKVKAMIKLLNEDADSFARRAEMY
YKKRPELMKLVEEFYRAYRALAERYDQATGALRQAHKSISEAFPNQMPPMSDESPASSGQ
EVEPHTPDLPTFTRLPFDLDDLQKDGIGVSPQQFTSKRNGTHPEEAIALPNRKGFDVKVR
KGLSFGSPEVKGSDAISNEMVNLQQEISRLLAESNSMKQQILSESERANKAENEIQVLKD
TVLKLNSDKDTSLLQYNQSTERLSTLESELSKAQDDLKKLTDEMATEVQKLSSAEARNSE
IQFELEALDQKVKMQQEELEQKQKELKSFNLTFQEEQDKRLQAESALLSEGKELAQCQEE
VQRLTMEIQMANEKLNELKQTKVNLENAVSELKKEVESLTEQNRSSELLIQELRDEINSL
TDSRNELQNEIQSLRSTISQLNTEKDAALFQHQQSVERVSDLESQLLKLQPELEEIEQKV
QMLMQDLEQKRQEADNAHAQLQDECNRHTQTEADLHRFKNLHSQLEEEVTKLTENLDRST
KGLEELENAKLDLENTSRELKSTILDLKSEKDAVLLQQQQSLAKISDLELQLSKTQLELK
NSEQKMQLLELEITQKSESMDSLTLSLKDETEKRVQAETSLISMENMYSQSQEEVNRLHL
EIEKLNSKLNELENLSSELNSTILLLNAEKDATDLKNQQSLVRISDLESELSKLQAQLEK
IEGKVQMLEQELKHKKEEVDSLQINIQDEAHKRSEGEAALLSMTNLNSESQEEVNRLTLE
TEKLKVKLSEVENSNTDLENIVAKHTEDIHVLREKNVSTELMIKELHHELEALKELNVKL
ESEMGLHIGEKEALQRNFACQKEEKQNLEGIHHSMAEEMSTLKSRSAANQKLIEDLQIMN
LKLKEVCAKNEVEKALLSEKVQEVEKLSEEFSLMENSLSDANAEMDSLREKIKVLEASEG
SLKDVISSHVSEKAILTSDLETLGKNYADISEKNSNLDILISDMKAEIENLRTKLKDSEE
TCQAHLANNSALSDEKNNVFSQLESVTVVMKALESKHADLEDKSSSLSKEMNLAYDQIRE
LQDQLRIKDEEYEAFVKSHQTQVNDFEEQISSLQKKSYYMNELLEQEQENNMSASINVVI
LENCLADLKDKNVDLFNECQKFAEANHAAEMLISQMKDEARYHQDERKFLLIHTEKLREG
ISQHMKVLNICKDLGPANIAEDEIILQTVSDEASNIMKLKDQSEDANRLMYTELTVLATV
MLQVGLELRDLNLQKRALEKELETRAAEFITLQNNNVQMLEWNEQLKQELQQGCEREEVL
KAEILVLQEKLSCSRDSYQTSQNEIVSLTEKNETLCKEYQSLIEKYNALEDENGALLSEC
MRLEHLSLFLRGHNNEVATALGSLTDEMALLGVGKDELDCEVQELSRRGMMLESENNNLK
EYFIYLIEILSAQLALSEFDLNINQSICQELASELESCMAQLSQKDDELLEAEDKVHLLQ
GKNRELCGVVGSLQVAIEGAKIVKEELEKKIATLTEEGNTKDGEISLLHQANERLQVEAD
ILKDKEDSMTSSHELLSKEVEQREGEFVVLMGDVITSSVNAAVYEEKALELMMENTELKA
NLSTHVALIASLSDHVNELEENTLSLSKPYSTESKKEDAEVPFMQERSHGPESHPLPEGT
PELQRLIARMGALQVAILNAKDLHDQESTKSAATLAAAHRDIEELKARGGSQMEAREIYS
DNEKLNNIEGSKGKQVQMMKDIELDQISTCPPYGTGAALYPLKNGANAGMDDEMLQLWEA
AERSCKNQTSKSSSAEHDIEAVEEVKSEYPSSELARGRDLGINKLEVSTSSVEPHEQWSN
NVLEKLSSDAQRLQSIQVSIEELKRKMGSPSNGKSPMNSEYNTVSTQLLDTEGCVLEQIN
YNNKLTKRVENYPALSDSMNAEQEGYPSRRKISGQVQKGSENVGRLELELQKIQYVLLKL
EEEHEYRRLKVSDKRTRVLLRDYLYGRKEKRGGAQKKKKRAPFCGCVQSRTET
Download sequence
Identical sequences A0A0D3HDT4 I1QUL7
OBART10G10410.1 ORGLA10G0090000.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]