SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OBART11G06820.1 from Oryza barthii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OBART11G06820.1
Domain Number 1 Region: 120-467
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 4.52e-113
Family IF2B-like 0.0000000752
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OBART11G06820.1
Sequence length 529
Comment pep:novel chromosome:ABRL00000000:11:5514201:5526051:1 gene:OBART11G06820 transcript:OBART11G06820.1 description:""
Sequence
MNTFGRRSNTWSARMNRVLDLHRPLGSTVARHCSVAPDILSLRTLVGGSNRITRIQRGLG
EKAAKHSSDIYSSPDTQGTDKIASGGASSTRSSTPPDSPGFLSISAEFRSAPAMGELGAL
QSIVYHRGSLRLLDQRKLPLEVDYIDVKCSGDGWNAIRDMVVRGAPAIAIAAALALAVEV
SGLEDFTATPAEAAAFVSEKLEYLVSSRPTAVNLSDAATKLRSLVSRTAETAKDAKAIFQ
AYIDAAETMLVDDVSDNKAIGSHGAEFLKQKLEVSKDISVLTHCNTGSLATAGYGTALGV
IRALHSGGILEKAFCTETRPFNQGSRLTAFELVHDKVPATLIADSAAAALMKSGCIQAVI
VGADRIAANGDTANKIGTYNLAISAKHHSVQFYVAAPITSIDLSLPSGEQIVIEERSPNE
LLNSEGGLGKQVAASGISVWNPAFDVTPANLITAIITEKGVITKSDADETFNIKDFIQSA
KLEINSIPSASTPRDSRLGPPPISIPRPDQGAPPSRCSHPISIPSHPDR
Download sequence
Identical sequences A0A0D3HJM6
OBART11G06820.1 OBART11G06820.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]