SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OBART11G15270.1 from Oryza barthii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OBART11G15270.1
Domain Number 1 Region: 143-277
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.37e-40
Family B3 DNA binding domain 0.0038
Further Details:      
 
Domain Number 2 Region: 719-793
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.00000000118
Family PB1 domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OBART11G15270.1
Sequence length 858
Comment pep:novel chromosome:ABRL00000000:11:15636669:15642144:-1 gene:OBART11G15270 transcript:OBART11G15270.1 description:""
Sequence
MATAEVGGGGGEGDAAAAAVARGGGGGGGGGGGEDALFTELWSACAGPLVTVPRVGEKVF
YFPQGHIEQVEASTNQVGEQRMQLYNLPWKILCEVMNVELKAEPDTDEVYAQLTLLPESK
QQEDNGSTEEEVPSAPAAGHVRPRVHSFCKTLTASDTSTHGGFSVLRRHADECLPPLDMS
RQPPTQELVAKDLHGVEWRFRHIFRGQPRRHLLQSGWSVFVSAKRLVAGDAFIFLRGENG
ELRVGVRRAMRQQANVPSSVISSHSMHLGVLATAWHAVNTGTMFTVYYKPRTSPAEFVVP
YDRYMESLKRNYSIGMRFKMRFEGEEAPEQRFTGTIVGMGDSDPAGWPESKWRSLKVRWD
EASSIPRPERVSPWQIEPAVSPPPVNPLPVPRTKRLRPNATALPADSSAIAKEAATKVVV
ESEPNGTQRTFQTQENATPKSGFGNSSELESAQKSIMRPSGFDREKNNTPIQWKLGSDGR
MQMSKPESYSEMLSGFQPPKDVQTPQGFCSLPEQITAGHSNFWHTVNAQYQDQQSNHNMF
PSSWSFMPPNTRLGLNKQNYSMIQEAGVLSQRPGNTKFGNGVYAALPGRGTEQYSGGWFG
HMMPNSHMDDTQPRLIKPKPLVVAHGDVQKAKGASCKLFGIHLDSPAKSEPLKSPSSVVY
DGTPQTPGATEWRRPDVTEVEKCSDPSKAMKPLDTPQPDSVPEKPSSQQASRNMSCKSQG
VSTRSCKKVHKQGIALGRSVDLTKFKGYEELIAELDDMFDFNGELKGPKKEWMVVYTDNE
GDMMLVGDDPWIQSFLNSEFCDMVHKIFIYTREEVQRMNPGTLNSRSEDSHANSMERGSV
GREMRGCLSTSSLNSENC
Download sequence
Identical sequences A0A0D3HME8
OBART11G15270.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]