SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OBART11G16060.3 from Oryza barthii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OBART11G16060.3
Domain Number 1 Region: 2-94
Classification Level Classification E-value
Superfamily Aminoacid dehydrogenase-like, N-terminal domain 8.63e-29
Family Malic enzyme N-domain 0.0000465
Further Details:      
 
Domain Number 2 Region: 159-254
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000000334
Family B3 DNA binding domain 0.0031
Further Details:      
 
Domain Number 3 Region: 303-399
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000216
Family B3 DNA binding domain 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OBART11G16060.3
Sequence length 405
Comment pep:novel chromosome:ABRL00000000:11:16318523:16327499:-1 gene:OBART11G16060 transcript:OBART11G16060.3 description:""
Sequence
MDLQERNERLFYKLLINNVEELLPVVYTPRSTGQSLFFRRPQGQEKMFELLRNWPEESIQ
VIVVTDGERILGLGDLGCQGMGIPVGKLALYTALRVCVVKSAYSSKVRESLAAGRRGHWH
SHSAPLLWLLPGYNYGSTDILHGQADHGKSTLPAIGMDPPIFSTVRLTTGNQHYVRVPSA
ITRTYQLEDEQNVKLVTAHELEVNIRIQKSSNKLYMTEGWEEFIEATGLQLGEYVVFKAL
SSSKIHVIVLNKNGHLRCPVPEDISESEAAPNRPAPSKRTVKEMHQAITEVKNYIKDIAQ
FLHRSNKFDITTINATFMKQDRVYFSKEFSRKYIAPLARRKTLKIKVQLAGHPSSTMILH
KSTDDRYNLKAGWAHFAIKNNIELGSLCIFHFYKTNQLQATIDVL
Download sequence
Identical sequences A0A0D3HMP4
OBART11G16060.3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]