SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OBART12G07990.1 from Oryza barthii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OBART12G07990.1
Domain Number 1 Region: 148-324
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.65e-31
Family G proteins 0.09
Further Details:      
 
Domain Number 2 Region: 62-131
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000275
Family B3 DNA binding domain 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OBART12G07990.1
Sequence length 332
Comment pep:novel chromosome:ABRL00000000:12:7173014:7177648:-1 gene:OBART12G07990 transcript:OBART12G07990.1 description:""
Sequence
MVAAAIRREGSSSMSNATAAEDAEDCSATSLMPESKKEEGKGEMGGVVRSFSTQFAEFEA
FSIPFSEQYINEHLPIEDLLVTVVGSTVSYPMRLMKSKGKQATFTTGWNKLVGDKLFELC
DVCVFMFSENDAELTLSLELLNNSFMYDHSSTLMRKYDDRIINLIVLTYLIVVDDIWDIG
AWKVVSCAFPENNLGSIIITTTRNAAVAKACSRTTSEGYLHSMQPLAEQESQRLFYRRAF
NSESCCPPHLEDISHAIISKCRGLPLAIISIASLLATKSDSEDQWVQVHDTIGASLNSEA
RVRKILMLSYYDLPYPPKKYPLYLSMYPEDWL
Download sequence
Identical sequences A0A0D3HT50
OBART12G07990.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]