SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OBART12G08000.1 from Oryza barthii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OBART12G08000.1
Domain Number 1 Region: 62-131
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000392
Family B3 DNA binding domain 0.0081
Further Details:      
 
Domain Number 2 Region: 300-365
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000319
Family G proteins 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OBART12G08000.1
Sequence length 403
Comment pep:novel chromosome:ABRL00000000:12:7177739:7185520:-1 gene:OBART12G08000 transcript:OBART12G08000.1 description:""
Sequence
MVAAAIRREGSSSMSNATAAEDAEDCSATSLMPESKKEEGKGEMGGVVRSFSTQFAEFEA
FSIPFSEQYINEHLPIEDLLVTVVGSTVSYPMRLMKSKGKQATFTTGWNKLVGDKLFELC
DVCVFMFSENDAELTLSLELLNNFRVLNPLLTKLSSLIEGEYKLLKSVKKDIIFLRNELS
SISVLLEHLSNKEDKLDGPTMEWRNNMLELAYDIEDCIDLFIHKLSCGDANANFVRKIGS
KIKKLWGKHQITECIQELKNRIDDFISEPSMVEIDPRLLALYEEVERLVGIDGPREKIVK
TTLANELYKTIQGDFKCTTFVSISRTPNIRKVLVDMLKGLGSNGDVSEDEQNLISHLRGF
LKDKSRVERRKAGYRSFIGDGRQGGLRAIAGEAALGRRRARRP
Download sequence
Identical sequences A0A0D3HT51
OBART12G08000.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]