SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OBART12G17530.1 from Oryza barthii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OBART12G17530.1
Domain Number 1 Region: 721-819
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.53e-22
Family B3 DNA binding domain 0.0013
Further Details:      
 
Domain Number 2 Region: 234-334
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 6.87e-21
Family B3 DNA binding domain 0.0028
Further Details:      
 
Domain Number 3 Region: 1422-1523
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 6.47e-20
Family B3 DNA binding domain 0.0069
Further Details:      
 
Domain Number 4 Region: 593-699
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.53e-18
Family B3 DNA binding domain 0.0084
Further Details:      
 
Domain Number 5 Region: 1081-1186
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 9.42e-18
Family B3 DNA binding domain 0.0085
Further Details:      
 
Domain Number 6 Region: 930-1029
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.84e-17
Family B3 DNA binding domain 0.0052
Further Details:      
 
Domain Number 7 Region: 1202-1305
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.92e-17
Family B3 DNA binding domain 0.0023
Further Details:      
 
Domain Number 8 Region: 98-188
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 5.49e-16
Family B3 DNA binding domain 0.0042
Further Details:      
 
Domain Number 9 Region: 442-546
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000000883
Family B3 DNA binding domain 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OBART12G17530.1
Sequence length 1535
Comment pep:novel chromosome:ABRL00000000:12:18205385:18217895:1 gene:OBART12G17530 transcript:OBART12G17530.1 description:""
Sequence
MMNNTPCGHEGSMSYHDNHLQSPSESSLLFNISLPPHSPFQELSGVDSTSLLVSDPTNMQ
QFCLRCSWTNPKRLAKPSLAIASLSHQHLAFDKTRCMFILKIENDTLKTILKMFAKNVQG
LISGVAKLEVPDGKTYDVEISKEHNELVFRSGWEVFAIAYELEQGDILAFGYSGNSHFKV
QIFNPSNCEKELSCVVMNRSISDDNHRQSPRRERMNKPSTTCMDCITNHYWLHMDDRERY
FFKVMMSVSDIKDELAIPKKFAANVRGKIPEQVRLEVSDGKMYNVQVTEEQDELVLRSGW
ANFSSTYQLKHGDLLVFIHSGHSHFKVLIFDPSCTEKEFSCVVTDNTSHVHERSISHDNH
LQSPRSEILGKNYSLCSSRKRSRMNPADYPSQRPDVPSSEDIKDPMSSGGLQKSKKSCYV
LPMLYNMTSAQEAEVLALEKKIQPQIPLYITAMDKTSVASGSLVFSKDYAVRYLLDQNRT
IKLCQSGGSKTWDISLDMDTDDLYALSTGWLDFFRGNLLQEGDICVFEASMSKRGVALTF
HPFKESHCPKSSEYTLSTKSPTRRVPKRDYFATNLTNLTDQQERKVKNKIKSIQSDIPIF
LSVMRSSNCTRQSSLCFSVKYASKYLPHKDQNMRLRLPETKYKCKAALHIDTSTNLHKLL
KGWGKFVNDNKLEIHDICLFQLMKNKKKLTMTVHIIRKGEMEKSHRVCKNCVANHYWLHM
DNHGKSFIKVMITDFKNGVTIPAKFARNFGGQMSGTVKLETRNGKTYEVQVAKELNNLVL
RSGWERFASAYELEKGDILVFIYSGNSHFKVWIYDPSACEKELPCIITEQLPRVQQRSIS
HNNHTQLKRNAKSAKLYVDSSGHSKETSEINPANSPSWKPTERVPSSEELDEPVDLANVQ
KATKSFYSLPRMCNMTSAQKAEVDALEKRIKPQIPFYITVMDKASATDGLLAISKDYAVS
YLLDKNETIKLCHSGRSMTWDISLDIDTDDQYALSTGWLDFIRNNHLQEGDICVFEASKN
KRGVALIFHPLKQSHHPKPPGCVPSTKFPRHGVSKPNYIVSRFTTLSGQLKIKVEAKVQA
IQSEIPIFVAVMRESFIRGRSRYMCFSAKYAAKYLPREKNKIMRLRLPNKSYKYKAVFKI
NNKVHKLGGGWGKFVDDNKIKLGDICLFQLMKNKKKLMMMVMGEKGCESCRKWQEHYYRE
HMDVSRIRFFRLMTGDFAHGISIPEKVAEIFSGQITKGFNLKSPSGETWRVGVAKVADEL
ILKSGWEDFAKAHELQENDLLFFTCNGHGNGSCSFDVLIFDASGCEKVSCFFTGKKNSYM
CKNFNSIGGQVAGQYLSSDSEDTSTPSVLIGSPHKASTSKKLSGKTKTNPRKEPEDPNCS
HWHVIEEKNTDDDEHADYHYTRFANYLTGEERDEIFSLVSLQPGNPVFVVVLQTAHVRRR
NILIVPTRFAADHLERKSHDILLIRPNRKQKWSVKYYYLSNTTRGFNCHRWIKFIRENRL
REGNVCIFELMKGARRPTMTVHVIGKADNRFVLLG
Download sequence
Identical sequences A0A0D3HWA3
OBART12G17530.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]