SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OBART12G18940.1 from Oryza barthii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OBART12G18940.1
Domain Number 1 Region: 61-242
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 6.96e-61
Family Branched-chain alpha-keto acid dehydrogenase Pyr module 0.0000145
Further Details:      
 
Domain Number 2 Region: 247-377
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 1.7e-35
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OBART12G18940.1
Sequence length 378
Comment pep:novel chromosome:ABRL00000000:12:19445180:19448261:1 gene:OBART12G18940 transcript:OBART12G18940.1 description:""
Sequence
MATAAAASLQYALHGAASASASAKPRSAAPGRSVRVAAARRSASADATAESKSGGHEVLL
FEALREALIEEMKEDPTVCVFGEDVGHYGGSYKVTKGLAEMFGDLQVLDTPIAENSFAGM
GVGAAMKGLRPIVEGMNMGFLLLAYNQISNNCGMLHYTSGGQFKIPIVIRGPGGVGRQLG
AEHSQRLESYFQSIPGLQMVACSTPYNAKGLMKAAIRSENPVVLFEHVLLYNLKEKIPDE
EYICCLEEAEMVRPGEHVTILTYSRMRYHVMQAAKTLVNKGYDPEVIDIRSLKPFDLHTI
GNSIKKTHRVLIVEECMRTGGIGASLRSAIIDNFWDYLDAPIMCLSSQDVPTPYAATLED
ATVVQPAQIVAAVEQICQ
Download sequence
Identical sequences A0A0D3HWT3
OBART12G18940.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]