SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|348030615|ref|YP_004873301.1| from Glaciecola nitratireducens FR1064

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|348030615|ref|YP_004873301.1|
Domain Number 1 Region: 72-159
Classification Level Classification E-value
Superfamily CO dehydrogenase ISP C-domain like 2.36e-33
Family CO dehydrogenase ISP C-domain like 0.00055
Further Details:      
 
Domain Number 2 Region: 2-77
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 2.36e-27
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|348030615|ref|YP_004873301.1|
Sequence length 171
Comment (2Fe-2S)-binding protein [Glaciecola nitratireducens FR1064]
Sequence
MISFTLNNKAIEVDADPNMPLLWALRDMLDMTGTKYGCGIAQCGACTVHMDGEPIRSCVM
PLASIAGKKITTIEGLPSDASHPIQQAWLEHNVPQCGYCQSGQIMSAVALLSNNPNPDDA
AIDNAMQGNICRCGTYPRIKAAIKDAASKSATTSASNNFDFSLAKNVGEKV
Download sequence
Identical sequences G4QE34
WP_014110179.1.47640 gi|348030615|ref|YP_004873301.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]