SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|348030724|ref|YP_004873410.1| from Glaciecola nitratireducens FR1064

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|348030724|ref|YP_004873410.1|
Domain Number 1 Region: 253-775
Classification Level Classification E-value
Superfamily Formate dehydrogenase/DMSO reductase, domains 1-3 2.75e-189
Family Formate dehydrogenase/DMSO reductase, domains 1-3 0.00000000171
Further Details:      
 
Domain Number 2 Region: 790-933
Classification Level Classification E-value
Superfamily ADC-like 2.94e-39
Family Formate dehydrogenase/DMSO reductase, C-terminal domain 0.0011
Further Details:      
 
Domain Number 3 Region: 109-249
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 4.14e-37
Family Ferredoxin domains from multidomain proteins 0.0057
Further Details:      
 
Domain Number 4 Region: 34-107
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 8.41e-18
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|348030724|ref|YP_004873410.1|
Sequence length 968
Comment formate dehydrogenase subunit alpha [Glaciecola nitratireducens FR1064]
Sequence
MVNYFNPATDIVAPQPKFDVNKDYGTPPSESTETVNIQVDGVTITVAEGTSVLRAAALAD
INIPKLCASDNLTAFGSCRLCAVQIEGMRGYPASCTTPVKEGMVVTTQNDDIGKLRRNIM
ELYISDHPLDCLTCSSNGDCELQDMAGAVGLREVRYGFDGDNHLDAKIDDSNPYFTFEPS
KCITCSRCVRACEEVQGTFALTIEGRGFKSKVSAGTSEENFISSDCVSCGACVQACPTAT
LMEKSVIDKGQPEHSVITTCAYCGVGCSFKAEMKGEEVIRMVPYKGGKANQGHSCVKGRF
AFGYATHKDRITEPMIRDSIDQPWREVSWEEAIAFSADKIKGIQAKYGRDSVGGITSSRC
TNEETYLVQKLIRAAFGNNNTDTCARVCHSPTGYGLKATIGESAGTQTFESVMKSDVIMV
IGANPTDAHPVFASLLRKRLRQGAELIVVDPRSIDLLNTAHISANHHLALRPGTNVAMIN
AIAHVVISEGLEDKQFIENRTDEYNAWREFILDDINSPEAMAEITTVDAEEIRKAARIFA
KAKNGAIYYGLGVTEHSQGSTMVMGIANLALATGNIGREGVGINPLRGQNNVQGSCDMGS
FPQELPGYQHVSDNALRAKFEKSWGVTLDNEPGFRIPNMFDAAIEGTFKAMYVQGEDILQ
SDPNTQHVQAALSSLECLIVQDIFLNETAMYAHVFLPGSSFLEKDGTFTNAERRINRVRK
VMKPLAKYADWEVTQMLSNALGYPMNYQHPSEIMDEIASLVPTFSRVNYKKLDEQGSIQW
PCNDEFPDGSPIMHVEHFPIGNGRFAITPYLGSEDRANRRFPLLLTTGRILSQYNVGAQT
RRTANQSWHQEDLLEIHPNDADERGIKDGDWLGITSRAGDTVLRAKVSDRMKNGVVFTTF
HHPISGANVITTDSSDWATNCPEYKVTAVQVEKVSSPSAWQTRYKDFTKKQKGPFNQSTE
AESKTIGS
Download sequence
Identical sequences G4QMZ8
gi|348030724|ref|YP_004873410.1| WP_014110288.1.47640

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]