SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|348030884|ref|YP_004873570.1| from Glaciecola nitratireducens FR1064

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|348030884|ref|YP_004873570.1|
Domain Number 1 Region: 286-363
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 0.00000000000011
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|348030884|ref|YP_004873570.1|
Sequence length 372
Comment Na+-transporting NADH:ubiquinone oxidoreductase subunit NqrF [Glaciecola nitratireducens FR1064]
Sequence
MMFKRVHKWLSLAVFIQLFIWLGSGFLLGKLDMDKAAGRDTLVRNNPTSFARFYENTDDN
SGAVNTPFVSVKSLLKNYPMTSEIELSRLFDQVIYKLKINAGQHDYQASHYKLVDAISGE
LIDLSAEELAPTDKKLIYQIARFSYKDSAFGSSQTQNPNLSADQSEKMSVAGLLYPPIED
LPRERNAVWQINVDDVSQTSIYIRAQTGDVIAHVNDETRWRDLLLMLHFMDYAEEGSFNN
WFIKIFAVMTLLLSGTGAWGLYRLFSDGRIKITWFDRNKMLLVHSEKLPKAVTLSASANS
SILDALSASNIEIRSICGGGGLCGTCKFKGEPELLITAADRERLTPDELALGYRLACQHV
MKEVSNIELNQH
Download sequence
Identical sequences G4QNL9
gi|348030884|ref|YP_004873570.1| WP_014110448.1.47640

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]