SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|348029191|ref|YP_004871877.1| from Glaciecola nitratireducens FR1064

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|348029191|ref|YP_004871877.1|
Domain Number 1 Region: 2-63
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 1.84e-17
Family 2Fe-2S ferredoxin-related 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|348029191|ref|YP_004871877.1|
Sequence length 64
Comment (Fe-S)-binding protein [Glaciecola nitratireducens FR1064]
Sequence
MLSHLEQQNIDVHFHCREGYCGACRTKLISGDVEYLTDPLAFIDDDEILPCCCKPISDIQ
IKLY
Download sequence
Identical sequences G4QGT9
gi|348029191|ref|YP_004871877.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]