SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|431799211|ref|YP_007226115.1| from Echinicola vietnamensis DSM 17526

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|431799211|ref|YP_007226115.1|
Domain Number 1 Region: 29-156,196-342
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 6.85e-38
Family NagB-like 0.001
Further Details:      
 
Domain Number 2 Region: 409-449,558-703
Classification Level Classification E-value
Superfamily LmbE-like 0.00000011
Family LmbE-like 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|431799211|ref|YP_007226115.1|
Sequence length 775
Comment 6-phosphogluconolactonase/glucosamine-6-phosphate isomerase/deaminase [Echinicola vietnamensis DSM 17526]
Sequence
MLSNYPLSEVEECFLKESGVKEITTKIPYLTVDNFPKLGLLTACRFLEWAAHNPNGVISL
PTGKTPEFFIKWTQFLLENWDSKKGKQIREDYGMSDLKKPVLKDLHFVQIDEFYPISSSQ
HNSFYHYVNKFYIDGFGLDPKKALLINSDDIPLAEGKHFSEIFPDLKVDLSLRFREAANK
QEKLQQESIFLIDKWCGEYEQKIREKGGIGFFLGGIGPDGHIAFNTRGSDIFSTTRLTET
NFETQAVAAGDLGGIEVSANRLVITIGLDTIVYNPEAVGIIIAAGEAKAQIVKDSLETDL
TNIHPATVLQKLKNGRFYLTKGGASKLTDSINTYYKTGEWTQAKTEKSILELCKKLGKYA
SRLKLEDLKNDPYTSLIPDLSENTVASVIQSTIDKLNRGIEKEENEVLLHTGPHHDDISL
GILPHITNQLSEKTNEAHFSVLTSGFTAVTNTFVIDTLLHTKKLLDEDQIQMVNYEDFFQ
TGYKLKMDKDVYHYLTNVASEDPEQQKRGLCHRVVRAVVEVFGVKNNQKLRETINDVISI
LKNSYDGEKNPPKIQKLKGMIREFEEELVWAHFGVKVRNVHHLRLGFYTGDIFTEQPDKK
RDVEPIVEMFREINPTKISLTLDPEGSGPDTHYKVLQATAEAVRQWSKEKDLSDLRIIGY
RNVWFKFEAAESNVIVPVSLGDLSVMEDSFANCYLSQVNASFPSYAHNGKFSTIAKRTWV
NQLNDVQLLLGKDYFYQHDMAKVRASHGLIFFKDMNVEEFIAHARELEKSIEGMI
Download sequence
Identical sequences L0G5J6
gi|431799211|ref|YP_007226115.1| WP_015267646.1.54562

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]