SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|447916537|ref|YP_007397105.1| from Pseudomonas poae RE*1-1-14

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|447916537|ref|YP_007397105.1|
Domain Number 1 Region: 3-184
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 1.02e-28
Family Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|447916537|ref|YP_007397105.1|
Sequence length 184
Comment cytochrome b561 [Pseudomonas poae RE*1-1-14]
Sequence
MNSEMIDRYPTSLRILHWARAVLIAGLLWAGWHMTGLDDEVASKYELYYPWHKSFGVLAF
MLVLVQIVLRWRTPVLPSPPATLAAHERFLSRLVQRAMYVLIVAVPLMGYSMSSTYTMSD
GVFFFGVNLPELLGKNDEWFVVFQRLHKVCAYTLLGLIVVHVLGALKHRFFDKDPRNDVL
RRML
Download sequence
Identical sequences L7HDU0
gi|447916537|ref|YP_007397105.1| WP_003234937.1.32547 WP_003234937.1.43553 WP_003234937.1.61950

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]