SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|447917941|ref|YP_007398509.1| from Pseudomonas poae RE*1-1-14

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|447917941|ref|YP_007398509.1|
Domain Number 1 Region: 2-130
Classification Level Classification E-value
Superfamily FlgN-like 1.28e-28
Family FlgN-like 0.0000803
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|447917941|ref|YP_007398509.1|
Sequence length 156
Comment putative flagella synthesis protein [Pseudomonas poae RE*1-1-14]
Sequence
MHHDETLLELIIDDLAPTQQLLELLKEESLALYGRDMPLLEEILARKQSLIVLLEQHGKK
RSQILTSLGLPADHDGLAQLASHSSVGDQLLAQSKALNQLLTQCQEANLLNGQSIQLQQA
TTANQLRILHGGEPPALYNAQGSTSRLVKPSTRSQA
Download sequence
Identical sequences A0A0W0NPW3 A0A1H0LRC3
gi|447917941|ref|YP_007398509.1| WP_015372772.1.32547 WP_015372772.1.52017 WP_015372772.1.61950 WP_015372772.1.9193 WP_015372772.1.92627

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]