SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|447918960|ref|YP_007399528.1| from Pseudomonas poae RE*1-1-14

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|447918960|ref|YP_007399528.1|
Domain Number 1 Region: 90-371
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.12e-68
Family RecA protein-like (ATPase-domain) 0.000000011
Further Details:      
 
Domain Number 2 Region: 49-125
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.29e-29
Family Cold shock DNA-binding domain-like 0.0000191
Further Details:      
 
Domain Number 3 Region: 1-46
Classification Level Classification E-value
Superfamily Rho N-terminal domain-like 0.00000000000239
Family Rho termination factor, N-terminal domain 0.00071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|447918960|ref|YP_007399528.1|
Sequence length 419
Comment transcription termination factor Rho [Pseudomonas poae RE*1-1-14]
Sequence
MNLTELKQKPITDLLQLAEEMGIENMARSRKQDVIFSLLKKHAKSGEEISGDGVLEILQD
GFGFLRSADASYLAGPDDIYVSPSQIRRFNLRTGDTIVGKIRPPKEGERYFALLKVDTIN
FDRPENAKNKILFENLTPLFPTVRMKMEAGNGSTEDLTGRVIDLCAPIGKGQRGLIVAPP
KAGKTIMLQNIAANIARNNPEVHLIVLLIDERPEEVTEMQRTVRGEVVASTFDEPPTRHV
QVAEMVIEKAKRLVEHKKDVVILLDSITRLARAYNTVIPSSGKVLTGGVDAHALEKPKRF
FGAARNIEEGGSLTIIATALVETGSKMDEVIYEEFKGTGNMELPLDRRIAEKRVFPAINI
NRSGTRREELLTADDELQRMWILRKLLHPMDEVAAIEFLIDKLKTTKTNDEFFLSMKRK
Download sequence
Identical sequences A0A023CCG3 A0A031J7U3 A0A075P9Z7 A0A0Q4EIC7 A0A0Q8CU94 A0A0Q8Y821 A0A0R2YJA2 A0A0R2Z530 A0A0R2ZYA9 A0A0R3A8I5 A0A0R3AJX7 A0A0R3CJ29 A0A0W0HP26 A0A0W0N9G4 A0A0W0NZ90 A0A0W0QCM5 A0A172Z8W4 A0A176V435 A0A177X757 A0A1B5DCS1 A0A1B5DUX0 A0A1B5EFQ8 A0A1B5F0E8 A0A1C1WGA9 A0A1C1WHY5 A0A1C3GYY7 A0A1E4W7D3 A0A1E4XLL4 A0A1G4VUU9 A0A1H0IW90 A0A1H1EAI4 A0A1H1LUD8 A0A1H3QIF8 A0A1H4W1S1 A0A1I7IEH9 A0A1N7UTQ8 A0A1S1V3U3 A0A1S2UZV6 A0A1T1HV82 A0A1V2J0Z0 A0A1V2K7K5 A0A1X7EJP4 A0A255XFK0 A0A257BNN2 A0A292D2I3 A0A2A9DK04 A0A2G0YXB6 A0A2G5LPI7 A0A2G5MRR9 A0A2G5MWC5 A0A2G5N0R2 A0A2H2YV36 C3K3Z0 E2Y0L1 I4KCS5 I4L8V3 L7HDX5 P52155 U1UFC1 W2DPF7
gi|447918960|ref|YP_007399528.1| MES00004909465 gi|229593267|ref|YP_002875386.1| 216595.PFLU5900 gi|387896278|ref|YP_006326575.1| WP_003176825.1.100003 WP_003176825.1.10779 WP_003176825.1.12315 WP_003176825.1.12410 WP_003176825.1.13214 WP_003176825.1.13776 WP_003176825.1.13898 WP_003176825.1.13928 WP_003176825.1.15213 WP_003176825.1.1594 WP_003176825.1.17199 WP_003176825.1.19012 WP_003176825.1.20001 WP_003176825.1.20697 WP_003176825.1.22052 WP_003176825.1.2370 WP_003176825.1.23922 WP_003176825.1.24305 WP_003176825.1.24311 WP_003176825.1.26746 WP_003176825.1.27009 WP_003176825.1.27494 WP_003176825.1.28219 WP_003176825.1.29680 WP_003176825.1.30624 WP_003176825.1.30670 WP_003176825.1.31153 WP_003176825.1.31306 WP_003176825.1.32412 WP_003176825.1.32547 WP_003176825.1.33245 WP_003176825.1.33691 WP_003176825.1.33834 WP_003176825.1.3483 WP_003176825.1.35520 WP_003176825.1.3564 WP_003176825.1.3642 WP_003176825.1.37686 WP_003176825.1.38616 WP_003176825.1.38630 WP_003176825.1.3950 WP_003176825.1.39939 WP_003176825.1.40252 WP_003176825.1.41736 WP_003176825.1.41795 WP_003176825.1.41997 WP_003176825.1.42421 WP_003176825.1.42628 WP_003176825.1.43553 WP_003176825.1.44253 WP_003176825.1.45182 WP_003176825.1.45974 WP_003176825.1.46713 WP_003176825.1.46942 WP_003176825.1.48276 WP_003176825.1.48837 WP_003176825.1.49288 WP_003176825.1.50491 WP_003176825.1.5074 WP_003176825.1.50805 WP_003176825.1.50861 WP_003176825.1.52017 WP_003176825.1.52234 WP_003176825.1.52444 WP_003176825.1.52587 WP_003176825.1.52638 WP_003176825.1.53073 WP_003176825.1.53657 WP_003176825.1.54408 WP_003176825.1.5466 WP_003176825.1.55621 WP_003176825.1.55829 WP_003176825.1.56081 WP_003176825.1.56198 WP_003176825.1.57553 WP_003176825.1.58638 WP_003176825.1.59386 WP_003176825.1.596 WP_003176825.1.61950 WP_003176825.1.63201 WP_003176825.1.63407 WP_003176825.1.64703 WP_003176825.1.65293 WP_003176825.1.65725 WP_003176825.1.66055 WP_003176825.1.66605 WP_003176825.1.69491 WP_003176825.1.69539 WP_003176825.1.69582 WP_003176825.1.69732 WP_003176825.1.71454 WP_003176825.1.72742 WP_003176825.1.72990 WP_003176825.1.74404 WP_003176825.1.76300 WP_003176825.1.76956 WP_003176825.1.77673 WP_003176825.1.78564 WP_003176825.1.7917 WP_003176825.1.81112 WP_003176825.1.82007 WP_003176825.1.82050 WP_003176825.1.82111 WP_003176825.1.82491 WP_003176825.1.82779 WP_003176825.1.83774 WP_003176825.1.84868 WP_003176825.1.85673 WP_003176825.1.86165 WP_003176825.1.86221 WP_003176825.1.87624 WP_003176825.1.88435 WP_003176825.1.88896 WP_003176825.1.89324 WP_003176825.1.89787 WP_003176825.1.90418 WP_003176825.1.90907 WP_003176825.1.91674 WP_003176825.1.9193 WP_003176825.1.92627 WP_003176825.1.92916 WP_003176825.1.93164 WP_003176825.1.93661 WP_003176825.1.94171 WP_003176825.1.94645 WP_003176825.1.94976 WP_003176825.1.95948 WP_003176825.1.96428 WP_003176825.1.96441 WP_003176825.1.96784 WP_003176825.1.96849 WP_003176825.1.98091 WP_003176825.1.98872 WP_003176825.1.99590

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]