SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|565647144|ref|YP_008898440.1| from Cronobacter sakazakii CMCC 45402

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|565647144|ref|YP_008898440.1|
Domain Number 1 Region: 1-362
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 2.68e-111
Family FMN-linked oxidoreductases 0.000000000078
Further Details:      
 
Domain Number 2 Region: 333-518
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 2.47e-40
Family N-terminal domain of adrenodoxin reductase-like 0.00000228
Further Details:      
 
Domain Number 3 Region: 467-627
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.79e-24
Family C-terminal domain of adrenodoxin reductase-like 0.00000046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|565647144|ref|YP_008898440.1|
Sequence length 672
Comment 2,4-dienoyl-CoA reductase [Cronobacter sakazakii CMCC 45402]
Sequence
MSYPSLFAPLDLGFTTLKNRVLMGSMHTGLEEHPDGARRLAAFYAERARHGVALIVTGGV
APSPSGVAIQGGAVLNDAHHLPHHRVITDAVHREGGKIALQILHTGRYSYQPHPVAPSPL
QAPINRFAPHELTHDEILALIEDFARCASLAREAGYDGVEIMGSEGYLINQFLAARTNHR
EDEWGGDYARRMRFAVDVVRAVRERVGQDFIIIYRLSMLDLVEGGSTFDETVQLARAIEA
AGATLLNTGIGWHEARIPTIATPVPRGAFTWVTRKLRGQTSLPLVTTNRINDPHVAEAIL
AAGDADMVSMARPFLADAELLSKAASGREAEINTCIGCNQACLDQIFAGKVTSCLVNPRA
CHETEMVSVPARTPKKLAVVGAGPAGLAFAVNAAQRGHAVTLFDASAEIGGQFNIAKQIP
GKEEFYETLRYFRRMLAVTGVTLALNTRVEAAMLAEFDEVALATGIVPRVPDIDGIYHSS
VLTYLDVLRDKAPVGERVAIIGCGGIGFDTAMYLSQPGEATSQNIAEFCVEWGIDTSLNA
PGGLRPEGPVLPKSPRQIVMLQRRAGKPGDGLGKTTGWIHRATLLARGVKMIPAVSYQRI
DDRGLHVLINGEPQVLEVDNVIICAGQEPQQALAVPLRSMGKPVHLIGGCDVALELDARR
AIAQGTQLALEI
Download sequence
Identical sequences A0A0U4H9B3 V5U4W6
gi|565647144|ref|YP_008898440.1| WP_023899546.1.37109 WP_023899546.1.5266 WP_023899546.1.55414 WP_023899546.1.69775 WP_023899546.1.85350 WP_023899546.1.86471 WP_023899546.1.91071

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]