SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|565645111|ref|YP_008896407.1| from Cronobacter sakazakii CMCC 45402

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|565645111|ref|YP_008896407.1|
Domain Number 1 Region: 23-255
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.95e-54
Family Extended AAA-ATPase domain 0.000000272
Further Details:      
 
Domain Number 2 Region: 260-333
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.02e-24
Family Helicase DNA-binding domain 0.00091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|565645111|ref|YP_008896407.1|
Sequence length 336
Comment hypothetical protein P262_02311 [Cronobacter sakazakii CMCC 45402]
Sequence
MIEADRLVAPGSIVAEEVADRAIRPKLLEEYIGQPQVRSQMEIFIQAAKLRGDALDHLLI
FGPPGLGKTTLANIVANEMGVNLRTTSGPVLEKAGDLAAMLTNLEPHDVLFIDEIHRLSP
VVEEVLYPAMEDYQLDIMIGEGPAARSIKIDLPPFTLIGATTRAGSLTSPLRDRFGIVQR
LEFYQVADLQHIVSRSARHMGLEMNDEASFEVAKRSRGTPRIANRLLRRVRDFAEVRHDG
VINQHVASQALDMLNVDAEGFDYMDRKLLLAVIDKFFGGPVGLDNLAAAIGEERETIEDV
LEPFLIQQGFLQRTPRGRMATTRAWNHFGITPPQMP
Download sequence
Identical sequences A0A0K2PBV2 A0A0U4G849 K8AIX3 V5TYK3
gi|565645111|ref|YP_008896407.1| WP_007775934.1.29613 WP_007775934.1.37109 WP_007775934.1.48695 WP_007775934.1.5266 WP_007775934.1.55414 WP_007775934.1.69775 WP_007775934.1.70246 WP_007775934.1.70259 WP_007775934.1.75988 WP_007775934.1.7880 WP_007775934.1.8442 WP_007775934.1.85350 WP_007775934.1.86471 WP_007775934.1.91071

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]