SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Pilcr1|184819|CE85319_4135 from Piloderma croceum F 1598 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pilcr1|184819|CE85319_4135
Domain Number 1 Region: 45-157
Classification Level Classification E-value
Superfamily DOPA-like 2.48e-38
Family DOPA dioxygenase-like 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Pilcr1|184819|CE85319_4135
Sequence length 163
Sequence
MSWESPLKGYENADSLPTTINPDGKSLYNPPGPKSAAYDEFPKPIDSSNNGFDFHIYYIP
NDENETKFARELHERVRREFPELRIYKFWDKAVGPHPTAMFEVNTFNPHQTGAFFAWLVV
NRGPCSVLIHPNTGDGYKDHMELATWMGRPWSLNADKLKRIPH
Download sequence
Identical sequences A0A0C3GFM5
jgi|Pilcr1|184819|CE85319_4135

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]