SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|478458053|ref|YP_007731238.1| from Chlamydia trachomatis K/SotonK1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|478458053|ref|YP_007731238.1|
Domain Number 1 Region: 11-306
Classification Level Classification E-value
Superfamily SIS domain 3.11e-46
Family mono-SIS domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|478458053|ref|YP_007731238.1|
Sequence length 328
Comment D-arabinose 5-phosphate isomerase [Chlamydia trachomatis K/SotonK1]
Sequence
MYVPGIAENLCLDIFHKQKQVISQYFASFHYDCVHQLTEKLLCHQGSLFFSGIGKSGCIA
RKLVATMQSFGEKAFFLSGDLLHGDLGVVSPGDIVCLFSNSGETREILEWIPHLKNRPVF
LVGITAAPCSSLAAFSDFVIVLPKLEELDPFNLMPTTSTTCQLLFSDLLAMTLLRCRKIS
LSDYGSNHPSGQIGLKANGKVKDYLYPRTEVPFCSPLTTVAESLPTLSSYGYGCVCVVNE
LFELLGIFTDGDLRRGLSEYGGDILAYPLQQIMTRNPKVISEDSDVLLSLEMMESGNPVT
VLPVVDAQQQRFIVGLLHMHALARAGLL
Download sequence
Identical sequences A0A0E9CSQ8 A0A0H2X261 O84404
gi|478449027|ref|YP_007723950.1| gi|385239915|ref|YP_005807757.1| gi|385246301|ref|YP_005815123.1| gi|568111652|ref|YP_008921257.1| gi|478458053|ref|YP_007731238.1| NP_219909.1.57406 WP_009871751.1.100644 WP_009871751.1.101362 WP_009871751.1.102133 WP_009871751.1.13674 WP_009871751.1.14984 WP_009871751.1.20093 WP_009871751.1.31128 WP_009871751.1.34934 WP_009871751.1.38504 WP_009871751.1.4264 WP_009871751.1.42889 WP_009871751.1.52091 WP_009871751.1.55117 WP_009871751.1.60937 WP_009871751.1.6151 WP_009871751.1.61683 WP_009871751.1.62239 WP_009871751.1.62968 WP_009871751.1.65182 WP_009871751.1.67250 WP_009871751.1.69355 WP_009871751.1.71619 WP_009871751.1.71686 WP_009871751.1.72034 WP_009871751.1.72164 WP_009871751.1.74323 WP_009871751.1.75470 WP_009871751.1.77651 WP_009871751.1.86066 WP_009871751.1.87079 WP_009871751.1.92427 WP_009871751.1.93216 WP_009871751.1.9343 WP_009871751.1.93600 WP_009871751.1.97602 gi|527322908|ref|YP_008349105.1| gi|478457143|ref|YP_007725736.1| gi|385242692|ref|YP_005810531.1| gi|478459856|ref|YP_007733924.1| gi|385240838|ref|YP_005808679.1| gi|76789130|ref|YP_328216.1| gi|15605124|ref|NP_219909.1| gi|237802824|ref|YP_002888018.1| gi|478455334|ref|YP_007727524.1| gi|527320100|ref|YP_008346300.1| 272561.CT399 315277.CTA_0434 580049.JALI_3981 gi|478458955|ref|YP_007732139.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]