SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|378717852|ref|YP_005282741.1| from Gordonia polyisoprenivorans VH2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|378717852|ref|YP_005282741.1|
Domain Number 1 Region: 80-140
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000000196
Family NfeD domain-like 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|378717852|ref|YP_005282741.1|
Sequence length 142
Comment nodulation efficiency protein D (NfeD)-like protein [Gordonia polyisoprenivorans VH2]
Sequence
MSTLIWLVAVIVLLIGEMVSGDLVLLMLGGGALAATGVDFFVSPPIWVDVVVFAVVAVAL
LAFVRPVAKRHLMSRPALLTNVEALEGKHATVLASVDEHRGRVKIDGEEWSARAMTPGDH
FEPGEQVTVMQIDGATAVVWKG
Download sequence
Identical sequences A0A1V4Q9K7 A0A259VJB0 H0REH4 H6N1Q6
gi|378717852|ref|YP_005282741.1| WP_006370106.1.64076 WP_006370106.1.65848 WP_006370106.1.74722 WP_006370106.1.96716 WP_006370106.1.98463

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]