SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|378717351|ref|YP_005282240.1| from Gordonia polyisoprenivorans VH2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|378717351|ref|YP_005282240.1|
Domain Number 1 Region: 355-467
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 0.0000000000783
Family Histidine kinase 0.0052
Further Details:      
 
Domain Number 2 Region: 53-226
Classification Level Classification E-value
Superfamily GAF domain-like 0.0000000000829
Family GAF domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|378717351|ref|YP_005282240.1|
Sequence length 494
Comment putative two-component system histidine kinase [Gordonia polyisoprenivorans VH2]
Sequence
MSVSSRFGDRDLTPGGDEVGGTDFDSLIGLHSVKGSHYAQFRGVEERLGRVVGALDRISR
ALVQTAEGPETLVLSVVRAVAEHLEADWVVFALCDGELDRTGPRHLMMDGDGTIYAFEGV
QVARTPSHLPDEVLNRLNDILRNQLGELVRPVVADHHLHVPVHLDGRVVGGLSAWTPPRH
VVDSADLVVMRILARQAVVALLNAALLEESRHQLARAEDAYAKAREQATDLAVQNVELQR
TQRELSAVMRQRLVTEERERIARELHDSVTQSVLSAGVQIEVCRMECDPETAERLEVAGT
LTRNAVEQLRSVIYALNQSPSVEGLSLGEVLDELCSMHMPADLETEVRVVGRPRDLPDDV
QHAILRIAGEALFNTAVHAEATLARVVLTYGDHDVSLTVDDNGVGDPGHMRRVLRAATLG
DLAGRHRGLANMSARARELGGEFRIRRSRIGGVRVGVEIPAGTVTESTSLPRPTTESVRR
TAGTRSSLHQEVSR
Download sequence
Identical sequences H6MW60
WP_014359642.1.65848 WP_014359642.1.98463 gi|378717351|ref|YP_005282240.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]