SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NbS00001478g0013.1 from Nicotiana benthamiana 0.4.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NbS00001478g0013.1
Domain Number 1 Region: 254-519,559-610
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 3.29e-87
Family IF2B-like 0.00097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NbS00001478g0013.1
Sequence length 617
Comment protein AED:0.23 eAED:0.26 QI:0|0.42|0.37|1|1|1|8|0|617
Sequence
MIPPPRHLSADLSLPRPPQAPLSPLRRDSIPVGSYNPSEFSSPTTTDFPADDSSSPGWHR
RGSSGKFATSLPSAGFEMPAAKQNSFTVSRLTTVSKANVPLGVTDKDGEAQKERTASSKP
LKEKTTKAERRALQEAQRAAKAAAKDYVLYPFYRIVKLMLGCPDDYMPADGTKTATAASG
ELRSSNLNPVKIAKGTSQKKESPPVAAAEKKGSDRATDKDRKKDVPHPRMQFDDKSRVEK
AKKRSVGLRYLAGDISGGNARCIAMLQAFQESIKDYSTPPEKALIRDLTAKVNCYVSFLI
ECRPLSISMGNAIRFLKTRIAKLPLTLSESEAKATLLTDIDRFISEKIILADKVIVKHAV
TKIRDGDVLLTYGSSSAVEMILLHAHELGKDFRVVVVDARPKLEGRLLLRRLVGKGVKCT
YTHINAISYIMHEVTRVLLGAASVLSNGTVYSRVGTASVAMVANSFRVPVLICCEAYKFH
ERVQLDSICSNELGDPEAIAKVPGRMEINHLDGWSNSDNLQLLNLIQVSRTKMVPCFLLA
QLCLCTGDPEAIAKVPGRMDINQLDGWSNSDNLQLLNLIYDATPSDYVSMIITDYGMIPP
TSVPVIVREYRREYLWT
Download sequence
Identical sequences NbS00001478g0013.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]