SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NbS00005284g0009.1 from Nicotiana benthamiana 0.4.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NbS00005284g0009.1
Domain Number 1 Region: 79-154
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 8.24e-32
Family Skp1 dimerisation domain-like 0.000033
Further Details:      
 
Domain Number 2 Region: 5-65
Classification Level Classification E-value
Superfamily POZ domain 8.9e-22
Family BTB/POZ domain 0.00056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NbS00005284g0009.1
Sequence length 156
Comment protein AED:0.16 eAED:0.16 QI:161|1|1|1|1|1|2|214|156
Sequence
MSTSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTSIPLPNVTSKILAKVIEYC
KRHVDAVAKTDDKASEDDLKSFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADM
IKGKTPEEIRKTFNIKNDFTPEEEEEVRRENAWAFE
Download sequence
Identical sequences A0A0K0PTC5 A0A1J6KHZ1 A0A1S3ZSR1 A0A1U7WVY8
NbS00005284g0009.1 XP_009591491.1.42874 XP_009782768.1.57364 XP_016467343.1.3737 XP_019232097.1.74238

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]