SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NbS00006102g0024.1 from Nicotiana benthamiana 0.4.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NbS00006102g0024.1
Domain Number 1 Region: 308-611
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 4.94e-88
Family IF2B-like 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NbS00006102g0024.1
Sequence length 618
Comment protein AED:0.21 eAED:0.24 QI:0|0.5|0.42|1|1|1|7|0|618
Sequence
MESRRVPRTVSDPKVRQVGFFAPPDRSQSGPNIQFSSSPPVSDLSPSGNSLSPVMIPPPR
HLSADLSLPRPPQAPLSPLRRDSIPVGSYNPSEFSSPTTTDFPADDSSSPGWHRRGSSGK
FATSLPSSGFEMPAAKQNSFTVSRLTTVSKANVPLGVTDKDGEAQKERTASSKPLKEKTT
KAERRALQEAQRAAKAAAKDYVLHPFYRIVKLMLSCPDVYMPADGTKTATAASGELKSSN
LNPVKIAKGTSQKKESPPVAATEKKGSDRATDKDRKKDVPHPRMQFDDKSRVEKAKKRSV
GLRYLAGDISGGNARCIAMLQAFQESIKDYSTPPEKALIRDLTAKVNCYVSFLIECRPLS
ISMGNAIRFLKTRIAKLPLTLSESEAKATLLTDIDRFISEKIILADKVIVKHAVTKLRDG
DVLLTYGSSSAVEMILLHAHELGKDFRVVVVDARPKLEGRLLLRRLVGKGVKCTYTHINA
ISYIMHEVTRVLLGASSVLSSGTVYSRVGTASVAMVANSFRVPVLICCEAYKFHERVQLD
SICSNELGDPEAIAKVPGRMDINQLDGWSNSDNLQLLNLIYDATPSDYVSMIITDYGMIP
PTSVPVIVREYRREYLWT
Download sequence
Identical sequences NbS00006102g0024.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]