SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NbS00008477g0017.1 from Nicotiana benthamiana 0.4.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NbS00008477g0017.1
Domain Number 1 Region: 107-156
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 0.000000000000719
Family Skp1 dimerisation domain-like 0.0016
Further Details:      
 
Domain Number 2 Region: 36-94
Classification Level Classification E-value
Superfamily POZ domain 0.000000011
Family BTB/POZ domain 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NbS00008477g0017.1
Sequence length 156
Comment protein AED:0.27 eAED:0.27 QI:0|0|0|1|0|0|3|0|156
Sequence
MEEVEFKRKTPWAFEGNPYPNGRASSSSTIATGEKKMLTLKTCDNKEFPLEESLILQSEL
SKTMVKEERVSSILLPTIKSKTLTKIIGYLKKHAELTTHARVFISGKEFVNVALEELLDL
TVAVNYLKINGLLEFCCQAVADRLQNKSVEAVRKIF
Download sequence
Identical sequences NbS00008477g0017.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]