SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NbS00011877g0023.1 from Nicotiana benthamiana 0.4.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NbS00011877g0023.1
Domain Number 1 Region: 263-608
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 7.45e-89
Family IF2B-like 0.00038
Further Details:      
 
Weak hits

Sequence:  NbS00011877g0023.1
Domain Number - Region: 125-188
Classification Level Classification E-value
Superfamily Apolipophorin-III 0.00418
Family Apolipophorin-III 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NbS00011877g0023.1
Sequence length 615
Comment protein AED:0.10 eAED:0.10 QI:200|1|1|1|1|1|7|343|615
Sequence
MDPRRPSRVIDPKVRRVGFFAPHPHINDTDNRPGLSSSPSGNSMIPHAFESVSQAVPVPN
STSTSRPRRSSFDESEQLVGSYNPMQSVLGTSPASSGIGVEGEFSEDSTHWSRQTDCFGL
TSAARLTESKDDQERISAQVAETSNEVERNAKPLKGKTTKAERRALQEAQRAAKGAGKGG
ETSGTKLHGQSGNPSKKPSLKKDGGPVISSVATSETKGDDRSLEKDHKKDLPAPRMQFDD
KNRVEKAKKRAVVKKTEARNRVELFRHLPQYEQGTQLPDLESRFFHLDPMHPAVYKVGLQ
YLAGDVVGGNARCVAMLQAFQQAIRDYSTPREKTLGRDLTARINGYVSFFNECRPLSISM
GNAIRFLKARIAKLSLTLSESEAKAALYSDIERFINEKIVLADRVITRQAVTKVRDGDVL
LTFGSSSVVEMILLHAYELGKQFRVIVVDSRPRLEGKALLRRLVKKGLCCTYTHINAVSY
IMHEVTRVFMGAASILSNGTVYSRIGTACVAMVAHAFRVPLLICCEAYKFHERVQLDSVC
SNELGEPDAISKVPGRLDVNFSDRWTSNENIQLLNLMYDVTPSDYVSMIITDYGMIPTTS
VPVIVREYGREHLLI
Download sequence
Identical sequences NbS00011877g0023.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]