SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NbS00014373g0001.1 from Nicotiana benthamiana 0.4.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NbS00014373g0001.1
Domain Number 1 Region: 78-153
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 2.22e-31
Family Skp1 dimerisation domain-like 0.0000319
Further Details:      
 
Domain Number 2 Region: 5-65
Classification Level Classification E-value
Superfamily POZ domain 7.59e-21
Family BTB/POZ domain 0.00063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NbS00014373g0001.1
Sequence length 155
Comment protein AED:0.07 eAED:0.07 QI:0|1|0.5|1|1|1|2|666|155
Sequence
MSSSKMIVLKSSNGETFEVEEAVALESQTIKHMIEDDCADTSIPLPNVTSKILAKVIEYC
KRHVDATKAEDKASEDELKAFDSDFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADMI
KGKTPEEIRKTFNIKNDFTPEEEEEVRRENAWAFE
Download sequence
Identical sequences NbS00014373g0001.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]