SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NbS00025458g0005.1 from Nicotiana benthamiana 0.4.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NbS00025458g0005.1
Domain Number 1 Region: 48-122
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 6.54e-21
Family Skp1 dimerisation domain-like 0.0007
Further Details:      
 
Domain Number 2 Region: 7-39
Classification Level Classification E-value
Superfamily POZ domain 0.000000029
Family BTB/POZ domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NbS00025458g0005.1
Sequence length 134
Comment protein AED:0.16 eAED:0.17 QI:0|0|0|1|1|1|2|0|134
Sequence
MATEGKKMVTLKSNDDKEFEVEEAAVIQSEMIKNMIEDGCAISEEEDLKEFDDKFVNMGW
EELFDVIMGANYLNIHELMELCCQSAADRLKNRSVRAVREMLKITNDLTEEEEKEIINDA
SWAFEGPEIDDTVN
Download sequence
Identical sequences NbS00025458g0005.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]