SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NbS00039920g0005.1 from Nicotiana benthamiana 0.4.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NbS00039920g0005.1
Domain Number 1 Region: 70-146
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 1.2e-23
Family Skp1 dimerisation domain-like 0.00011
Further Details:      
 
Domain Number 2 Region: 6-66
Classification Level Classification E-value
Superfamily POZ domain 3.14e-18
Family BTB/POZ domain 0.00095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NbS00039920g0005.1
Sequence length 148
Comment protein AED:0.01 eAED:0.02 QI:0|-1|0|1|-1|1|1|0|148
Sequence
MSSKKVLVLKTSDGEEFEVDEAVAVRSEAIKNMVEDDCASNTIPLPNVESKTMTKVIEYW
KKHSEEGDELKDFDKNYVKVLNYTELYDLFLAANYLSEKELLDILCQETADRIKGKTPEE
IRKAFNIKNDFTPEEEEQIRQENAWAFA
Download sequence
Identical sequences NbS00021570g0001.1 NbS00039920g0005.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]