SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NbS00043095g0001.1 from Nicotiana benthamiana 0.4.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NbS00043095g0001.1
Domain Number 1 Region: 79-150
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 4.71e-21
Family Skp1 dimerisation domain-like 0.00043
Further Details:      
 
Domain Number 2 Region: 11-68
Classification Level Classification E-value
Superfamily POZ domain 0.00000000000249
Family BTB/POZ domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NbS00043095g0001.1
Sequence length 163
Comment protein AED:0.01 eAED:0.01 QI:0|-1|0|1|-1|1|1|0|163
Sequence
MASSTTGEKKILALKSGDNEEFYLEEFLVSQSELLKNMMKEEGVSSIPLPSIKSKTLVKI
IEYLKKHAELTPSNEEDFKNFEKEFVNVVLEELLDITVAVNYLKINGLLEFCCQAVADRI
KDKSVETVRKIFRIESDFTPEEEAEFRRETPGAFEGDLDDTTN
Download sequence
Identical sequences NbS00043095g0001.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]