SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NbS00053547g0010.1 from Nicotiana benthamiana 0.4.4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  NbS00053547g0010.1
Domain Number - Region: 624-717
Classification Level Classification E-value
Superfamily ABC transporter involved in vitamin B12 uptake, BtuC 0.0994
Family ABC transporter involved in vitamin B12 uptake, BtuC 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NbS00053547g0010.1
Sequence length 722
Comment protein AED:0.23 eAED:0.23 QI:57|0.65|0.80|0.95|0.8|0.85|21|664|722
Sequence
MIHTLLWSNCGANSPPYHRITRMGKVLGFMVLLALSALICEAAIFKPISDSHRSAALELF
TPTHGSFSSLEETYEALRTFEVLGIEKQSDIRASTCASVVDTLSSSSSALKDLFQALRVN
GILKCELNKKAFAGIAPRLKDAVNGASSLLDYYYSVGSLVLIKGLSSIVEVHLESADSVF
RAIKAFSQSDGRWRYSSSNPESSTYAAGNYSRIALESLAGIISFASSEIDQSLISMVKDD
ISKLFDGLEKYDDGAYYFDEKLVDARGHQGPLSASSAVVRGITAFAAVSAEKLNFPGDKI
LGLTRFLLGAGVPGNAKDLYYQIDALALLENNRVSIPLVLSLPASVLSLTRKNQLKVNVN
TVLGSAVPSLTVKLKQIFSSGSKDASVIDQLLLHVSDHKTIYATGGRTKVPIYITGAIKV
DTAEIAVLDNDIGNAETQNKLDFAGENSVSLSANHLQKLRLSFQLTSPLGHSFKPHQFII
SWGFSYRLDFSGENAISLSANHLQKLRLSFQLTSPLGHSFKPHQDFLGLVEKFFYLSGRY
DIQLTVGDACNGRYEIQLTVGDAVMENSFLQPLGSVELDFSEPPEKAARPPPQAVDPSSR
FGPKAEIAHVFRVPKKRPPRDLSYAFLALVLLPFLGFLVGVGGTLLILLRLYVNLKNFPT
ASGPAMFAILFHLLIAAVLSLYVLFWLQWNLFQTLTAWILGDILTIRRTQNPFTSGVHIC
QV
Download sequence
Identical sequences NbS00053547g0010.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]