SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|532354376|ref|YP_008444212.1| from Prevotella sp. oral taxon 299 str. F0039

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|532354376|ref|YP_008444212.1|
Domain Number 1 Region: 9-182
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.18e-30
Family Pyruvate oxidase and decarboxylase Pyr module 0.0033
Further Details:      
 
Domain Number 2 Region: 394-551
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.09e-17
Family Pyruvate oxidase and decarboxylase PP module 0.0098
Further Details:      
 
Domain Number 3 Region: 163-345
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 0.0000145
Family Pyruvate oxidase and decarboxylase, middle domain 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|532354376|ref|YP_008444212.1|
Sequence length 570
Comment 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylic-acid synthase [Prevotella sp. oral taxon 299 str. F0039]
Sequence
MYSSKCNVNILTDLMIQHGINTVVMCPGSRNTPLLNNFNESVNFQCFSVTDERSAGFYAL
GLAQMAKRKVAVCVTSGSALLNLLPAVAEAFYQRVPFVVISADRPESWIDQLDGQTLHQT
NALKPYVSASVSLPEPLNSEQEWQCNRLVNEALNRFHAPEACPVHINVPISEPLFQFNQA
ELAPQRKITSYFSVAPNQSGMEQVATLLLQAKRPIVVLGQANYTLLNKEHLDFLNSVAVL
LTEPLSGIDALSNFDDILSAHINDDCLLPDLVLYAGESVVSKRLKHFLRKQKEGNQVRFS
TQKNIEDTFSHLSLLIECSAIEGLKALYSACSTLQTDSHLMVTDEQLKEKKAYINLWNDL
SCKVKAVRNDFKTIYSSMQAVALFEQEIAQQQVDCAVHYANSSAVRLANIYALHRIYCNR
GVNGIEGCLSTSVGMSLDSSANVFCVIGDLAFFYDQNALWNNHLKGNMHILLLNNSGGGI
FNMLPNISETTSYETFVKAHHNTNAQGICQQNNVDYMAVHTEEELKSLLPQFVSHCGTRP
ILLEVFTNQQQDTEALKTYYQTIAQLSTKK
Download sequence
Identical sequences D3I9K3
gi|532354376|ref|YP_008444212.1| gi|532354376|ref|YP_008444212.1|NC_022111 WP_020967160.1.56685

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]