SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000000025 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000000025
Domain Number 1 Region: 39-470
Classification Level Classification E-value
Superfamily ALDH-like 1.7e-157
Family ALDH-like 0.000000000000189
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000000025   Gene: ENSNLEG00000000016   Transcript: ENSNLET00000000028
Sequence length 475
Comment pep:novel supercontig:Nleu1.0:GL397363.1:40121:135947:1 gene:ENSNLEG00000000016 transcript:ENSNLET00000000028 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPWACQSCYSETPLVGISAALPAATWVQISPLHPFYQNGCALGQIFINNEWHDAISRKTF
PTVNPSTGEVICQVAEGDKALETLDNGKPYVISYLVDLDMVLKRLRYYAGWADKYHGKTI
PIDGDFFSYTRHEPVGVCGQIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTPLTALYV
ANLIKEAGFPPGVVNIVPGFGPTAGAAIASHEDVDKVAFTGSTEIGRVIQVAAGSSNLKR
VTLELGGKSPNIIMSDADMDWAVEQAHFALFFNQGQCCCAGSRTFVQEDIYDEFVERSVA
RAKSRVVGNPFDSKTEQGPQVDETQFKKILGCINTGKQEGAKLLCGGGIAADRGYFIQPT
VFGDVDGMTIAKEEIFGPVMQILKFKTIEEVVGRANNSTYGLAAAVFAKDLDKANYLSQA
LQVGTVWVNCYDVFGAQSPFGGYKMSGSGRELGEYGLQAYTEVKTVTVKVPQKNS
Download sequence
Identical sequences ENSNLEP00000000025

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]