SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000000073 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000000073
Domain Number 1 Region: 44-161
Classification Level Classification E-value
Superfamily POZ domain 2.04e-17
Family BTB/POZ domain 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000000073   Gene: ENSNLEG00000000065   Transcript: ENSNLET00000000081
Sequence length 478
Comment pep:known_by_projection supercontig:Nleu1.0:GL397526.1:624526:629860:1 gene:ENSNLEG00000000065 transcript:ENSNLET00000000081 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRRGYSKPGSWGSFWAMLTLVGLVTRAAQRADVGGEAAGTSINHSQAVLQRLQELLRQG
NASDVVLRVQAVSTDEVRVFHAHRLLLGLHSELFRELLSNQSEAVLQEPRDCAAVFDKFV
RYLYCGELTVLLTQAIPLHRLATKYDVASLQRGVAHYMRAHLAGGAGPAVGWYHYAVGTG
DEALRESCLQFLAWNLSAVAASAEWGAVSPELLWQLLQRSDLVLQDELELFHALEAWLGR
ARPPPAVAERALRAIRYPMIPPAQLFQLQARSAALARHGPAVADLLLQAYQFHAASPLHY
AKFFDVNGSAFLPRNYLGPAWGAPWVINNPARDDRSTSFQTQLGPSGHDAGRRVTWNVLF
SPRWLPVSLRPVYADTAGTALPAARPEDGRPRLVVTPASSGGDAAGVSFQKTVLVGARQQ
GRVLVRHAYSFHQSSEEAGDFLAHADLQRRNSEYLVENALHLHLIVKPVYHTLIRTPK
Download sequence
Identical sequences G1QGP6
ENSNLEP00000000073 ENSNLEP00000000073 XP_003281162.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]