SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000000188 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000000188
Domain Number 1 Region: 175-272
Classification Level Classification E-value
Superfamily AMPKBI-like 6.02e-36
Family AMPKBI-like 0.00000461
Further Details:      
 
Domain Number 2 Region: 76-156
Classification Level Classification E-value
Superfamily E set domains 3.36e-27
Family AMPK-beta glycogen binding domain-like 0.0000103
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000000188   Gene: ENSNLEG00000000157   Transcript: ENSNLET00000000203
Sequence length 272
Comment pep:known_by_projection supercontig:Nleu1.0:GL397354.1:1481715:1500928:-1 gene:ENSNLEG00000000157 transcript:ENSNLET00000000203 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNTTSDRVSGERHGAKAARSEGAGGHAPGKEHKIMVGSTDDPSVFSLPDSKLPGDKEFV
SWQQDLEDSVKPTQQARPTVIRWSEGGKEVFISGSFNNWSTKIPLIKSHNDFVAILDLPE
GEHQYKFFVDGQWVHDPSEPVVTSQLGTINNLIHVKKSDFEVFDALKLDSMESSETSCRD
LSSSPPGPYGQEMYVFRSEERFKSPPILPPHLLQVILNKDTNISCDPALLPEPNHVMLNH
LYALSIKDSVMVLSATHRYKKKYVTTLLYKPI
Download sequence
Identical sequences A0A096ND29 A0A0D9S0K6 A0A1D5QWE9 A0A2K5HYR7 A0A2K5KHG2 A0A2K5X0G4 A0A2K6A145 A0A2K6AQF1 A0A2K6KHH4 G1QH07
ENSPANP00000010758 ENSMMUP00000016028 ENSMMUP00000016028 ENSNLEP00000000188 ENSNLEP00000000188 XP_003273262.1.23891 XP_005542135.1.63531 XP_008017525.1.81039 XP_011735074.1.29376 XP_011806652.1.43180 XP_011850582.1.47321 XP_011930826.1.92194 XP_015005215.1.72884 XP_015005225.1.72884 XP_017710371.1.44346 XP_017710372.1.44346 9544.ENSMMUP00000016028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]